Recombinant Proteins
- (2)
- (2,391)
- (1)
- (23,537)
- (5)
- (1)
- (1)
- (68)
- (547)
- (9,349)
- (23)
- (1)
- (7)
- (2)
- (13)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (70)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (26,478)
- (1)
- (1)
- (2)
- (1)
- (25)
- (36,443)
- (1,335)
- (2)
- (2)
- (32)
- (3)
- (787)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (123)
- (1)
- (144)
- (1,405)
- (3)
- (4)
- (7)
- (5)
- (1)
- (3)
- (1)
- (1)
- (1)
- (14)
- (11,447)
- (48)
- (6)
- (31)
- (16)
- (1)
- (10)
- (4)
- (110)
- (18)
- (2)
- (3)
- (119)
- (4)
- (148)
- (98)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,578)
- (2)
- (1)
- (160)
- (48)
- (11)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (21,952)
- (2,939)
- (4)
- (1)
- (2)
- (114)
- (2,860)
- (4)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (34,931)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (6)
- (1)
- (1)
- (8,296)
- (6)
- (4)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (14)
- (19)
- (1)
- (3)
- (3)
- (4)
- (36,975)
- (1,823)
- (1)
- (3)
- (285)
- (9)
- (66,416)
- (1)
- (15)
- (1)
- (2)
- (45,198)
- (10,339)
- (245)
- (168)
- (56)
- (3,358)
- (2)
- (1)
- (2)
- (1)
- (90)
- (557)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (5)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,302)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,100)
- (5)
- (22)
- (8)
- (4)
- (1,290)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,572)
- (1)
- (44)
- (79)
- (54,649)
Filtered Search Results
Invitrogen™ Human ARMCX4 (aa 1999-2085) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Novus Biologicals™ Recombinant Human PSMA7 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Recombinant Human YARS2 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Invitrogen™ Human MDM1 (aa 136-236) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human C11orf46 (aa 102-201) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human DYRK4, GST Tag Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Storage Buffer: 50mM Tris, pH 7.5, 150mM NaCl, 0.5mM EDTA, 0.02% Triton X-100, 2mM DTT, 50% glycerol Store at -80°C. At first use, aliquot and store at -80°C to avoid multiple freeze-thaws. |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | DYRK4 |
| Molecular Weight (g/mol) | 88.8 kDa |
| KinaseFamily | DYRK Kinase Family |
| Sequence | Full length |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human DYRK4, GST Tag |
| Accession Number | Q9NR20 |
| Gene Alias | AW049118; dual specificity tyrosine phosphorylation regulated kinase 4; dual specificity tyrosine-(Y)-phosphorylation regulated kinase 4; dual specificity tyrosine-phosphorylation-regulated kinase 4; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4; dyrk4; Dyrk4a; Dyrk4b; RAD51 associated protein 1; Rad51ap1 |
| Gene ID (Entrez) | 8798 |
| Formulation | 50mM tris with 0.5mM EDTA, 50% glycerol, 0.02% Triton X-100, 2mM DTT, 150mM NaCl and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Novus Biologicals™ Methionine Sulfoxide Reductase B Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | Methionine Sulfoxide Reductase B |
| Molecular Weight (g/mol) | 14.8kDa |
| Gene ID (Entrez) | 51734 |
| Formulation | Liquid. In 20mM Tris-HCl Buffer (pH 7.5) containing 1mM DTT, 0.1mM PMSF, 2mM EDTA, 10% Glycerol |
| Immunogen | SEPX1(U95C), 1-116aa. MGSSHHHHHHSSGLVPRGSHMSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFCIFSSSLKFVPKGKETSASQGH |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Invitrogen™ Human TSEN2 (aa 198-288) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Novus Biologicals™ Recombinant Human RPS12 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ SAP18 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
R&D Systems™ Recombinant Rat CCL20/MIP-3 alpha Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Purity or Quality Grade | 97%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 8.2 kDa |
| Gene ID (Entrez) | 29538 |
| Quantity | 25 μg |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | E. coli-derived rat CCL20/MIP-3 alpha protein Ala26-Met96 |
| Recombinant | Recombinant |
| Name | CCL20/MIP-3 alpha |
Novus Biologicals™ Recombinant Human FIBP His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Invitrogen™ Human ZNF768 (aa 23-104) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
R&D Systems™ Recombinant Mouse VEGF 120 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Purity or Quality Grade | 97%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Gene ID (Entrez) | 22339 |
| Structural Form | Disulfide-linked homodimer |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | E. coli-derived mouse VEGF protein Ala27-Arg146 (Gly117Glu & Glu118Arg) |
| Recombinant | Recombinant |
| Name | VEGF 120 |